PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015870158.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NF-YB
Protein Properties Length: 229aa    MW: 25111 Da    PI: 6.6026
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015870158.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.62.4e-5563159197
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqdrf+Pianv+rim+k+lP +akis+daket+qecvsefisf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+eg
  XP_015870158.1  63 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEFISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTIYLHRYREMEG 157
                     69********************************************************************************************* PP

           NF-YB  96 ek 97 
                     ++
  XP_015870158.1 158 DR 159
                     97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-5258164IPR009072Histone-fold
SuperFamilySSF471131.24E-3966163IPR009072Histone-fold
PfamPF008081.1E-2669133IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-1697115No hitNo description
PROSITE patternPS006850100116IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-16116134No hitNo description
PRINTSPR006151.2E-16135153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MERGGFHGYR KLPNTSSGLK LSDISARLSE INSSDNNNNQ TSAVAGAAAA TSAVAGDDNE  60
CTVREQDRFM PIANVIRIMR KILPPHAKIS DDAKETIQEC VSEFISFITG EANERCQREQ  120
RKTITAEDVL WAMSKLGFDD YIEPLTIYLH RYREMEGDRG TMRGEPLLKR TTTTTVEYAA  180
GSLGVAAFAP AFHIGHHHHH GFFGYIKEAS SGGSSQAALA NGETNAQFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4062154193NF-YB
4awl_B3e-4062154294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4062154294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015870158.11e-173PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W663e-80NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLD7SZ491e-108D7SZ49_VITVI; Putative uncharacterized protein
STRINGVIT_00s0956g00020.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.15e-78nuclear factor Y, subunit B6